PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000284572
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 1695aa    MW: 185156 Da    PI: 5.4878
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000284572genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.76.1e-09792834246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++W +eE el+++  + +G++ +++Ia+ +  ++t  +c+++++k
    MDP0000284572 792 NPWMPEEKELFIQKLTIYGKD-FRKIASFLD-HKTTADCVEFYYK 834
                      68*****************99.*********.***********98 PP

2Myb_DNA-binding28.34.2e-0910111051345
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                        WT eE   +++av  +G++ ++ I+r++   R+  qck ++ 
    MDP0000284572 1011 DWTDEEKSSFIQAVSSYGKD-FAMISRCIR-SRSQHQCKVFFS 1051
                       6*****************99.*********.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.51E-13777838IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-5786837IPR009057Homeodomain-like
PROSITE profilePS5129315.529789840IPR017884SANT domain
SMARTSM007171.5E-8790838IPR001005SANT/Myb domain
PfamPF002497.2E-6792834IPR001005SANT/Myb domain
PROSITE profilePS5129311.02610071058IPR017884SANT domain
SMARTSM007171.4E-610081056IPR001005SANT/Myb domain
SuperFamilySSF466897.18E-1010091058IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-510111052IPR009057Homeodomain-like
PfamPF002491.6E-610111051IPR001005SANT/Myb domain
CDDcd001671.41E-510121050No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1695 aa     Download sequence    Send to blast
MPPEPLPWDR KDFFKERKHE RSESLGSVAR WRDSPHHAPR DFNRWPSGDF RRPPGHGKQG  60
AWHVFSDDSG HGYGSSRSGD KMLEDESFRP SFSRGDGRYG RNSRDNRGPP YSQREGKGHS  120
WDARSGSPNM PVRPNHNEQK SQDDMLTYSS HQPSDFGSTW DQIQLKDQLD RMGGSTGLGA  180
GQKCERENSL GSIDWKPLKW TRSGSLSSRV SGFSHSSSSK SMGLVDSNEA KVDSQPKNAT  240
PVQSPSGEAT TGVTSAAPSE ETNSRKKPRL GWGEGLAKYE KKKVEVPDGS MNNDGSVCSV  300
GNTEPAHSLS SSLPDKSPRV TMFSDCASPA TPSSVVCSSS PGVEEKSFCK AVNIDNDIRN  360
FCGSPGHMSQ SHHEGFSFQL EKLDSNSIVN LDSSLLELLQ SDDPSSVDSS IRRPTALNKL  420
LIWKGEISKV LEVTELEIDS LENELKALNS DSGGSCPRPA TSSSLPVEDK DKSCKEHVTN  480
LITLPTALQI HSSGDTDVQK MCVDNRDQVE FCGIVNDEDI DSPGTATSKF VESLPLVSSS  540
DMMNQTDCSE DWDPIQTTIG EETCSVPCRC TEKTDPSTCG NSSMLLDKEI VAPACGVVDK  600
LSDSIFSANK EFASRASDIF SKLLTKEQYE VDPSGVSVPS SWKNDTLIKE KFAKRKRHLR  660
FMERVITLKF KAFQHLWKED MHLLSMRKYR SKSHKNIELS LRASNNGHQK HRSSIRSRFS  720
TPAGSLNLVP TTETINFTNK LLSDSQVKLY RNSLKMPALI LDKKEKMATR FVSSNGLVED  780
PCAVEKERAL MNPWMPEEKE LFIQKLTIYG KDFRKIASFL DHKTTADCVE FYYKNHKSDC  840
FKKAKKKPDL AKQEKSSANT YLISNGKKWN REMHAASLDI LGAASEIAAH AESSTRNRQT  900
YSRRLILGGY KNTNTSHGDD TMVERPCSFD TFGNERETAA ADVLAGICGS ISSEAVSSCI  960
TSSIDPVESN REWKCQKVDS LVRRPLTPDL MHNVDDETCS DESCGEMDPS DWTDEEKSSF  1020
IQAVSSYGKD FAMISRCIRS RSQHQCKVFF SKARKCLGLD LVHPQPGNGT SVGDDANGGG  1080
SDAEDACVLE TGSGISSDKS GCNMNEDLPS SVANMNDDEA DPAESMKSQT SPFRPEENNA  1140
MAEVDHGDGK PLKLLAFGDD TDIMDSGAMG GNVTENGILV AESLPVGEGI NSDPPNPECM  1200
VGEKLVGQNY FDRFGKELEG RDERTNRDAS GCHIPVSVHD LCGNASDQAT DGSCSGLNPE  1260
YLLEVSVELN SVQKPSVIPL PLENPLATAD TVGQDSAAIE CEKSLDQDRL SSTPDLQEGR  1320
DHQCSKSXGE DDSRKHLSGF PVYTNVEPLQ VIRGYPLQIA TKKETNGDIS CGNLSEAKPD  1380
RNINGHYMTQ DGFLQFGNCK PPCPEVDFPP VPLKVEQPGD SRKALSWSSS DSDKPSRNGD  1440
VKLFGKILSN PSKSSSSIHE NEEGAHNHQL SNKASNLNFT GYHSADGNSP LLKFDCGSYL  1500
GLENVPRSSY GGFWEGNKVL AGYPSFPDSA ILLAKYPAAF SNFPTSSSQM EQQPLQAVVK  1560
TSDGSINGLS IFPGMEINGS NGVVDYPVFS RGRDGGAKVQ PFTVDVKQQR QDMFDIPRRN  1620
GLDAITSLQQ QGRGIVGMNV MGRGGILVGG ACTGVSDPVA AIRMLYAKXE QYGGQAGSIV  1680
GEEESWRGGK GDIGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C2e-15756842994NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D2e-15756842994NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008368881.10.0PREDICTED: uncharacterized protein LOC103432458 isoform X1
TrEMBLM5XR660.0M5XR66_PRUPE; Uncharacterized protein
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49863352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-161MYB family protein